PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009630982.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 292aa    MW: 32542.3 Da    PI: 8.6911
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009630982.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer993.5e-3174129258
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                     +++rY+eClkNhAas+Gg+++DGCgEfmp  geegt +alkCaAC+CHRnFHR+e++
  XP_009630982.1  74 SRARYRECLKNHAASIGGNVTDGCGEFMPC-GEEGTLEALKCAACNCHRNFHRKEQQ 129
                     5789*************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.5E-2876128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-2977127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2177127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.39978127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.08E-16222282IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-29223285IPR009057Homeodomain-like
TIGRFAMsTIGR015652.5E-28224281IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MALAGEDKEM RMQGSLGYHS LDQNLDQGNH HHHHQPNNNN LQPQQDHEKS SSGAAPVVPY  60
SSGGSTNNKF KITSRARYRE CLKNHAASIG GNVTDGCGEF MPCGEEGTLE ALKCAACNCH  120
RNFHRKEQQH VGADNNNNAG IMVVHPLQLP QPLPSPLPSM NHHHQHGRSV WSTMPPQPVK  180
MAFRGSGGGG SGATDSSSEE LNFNTYQQAT SVPPQPQPPF VLAKKRFRTK FTQDQKEKML  240
EFAEKLGWRI PREDDTEVQR FCSQVGVKRQ VFKVWMHNNK NPSAKKNPQE EP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-242252821875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009630982.10.0PREDICTED: zinc-finger homeodomain protein 5-like
SwissprotQ9ZPW72e-61ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLM0ZWJ41e-120M0ZWJ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000095811e-120(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.17e-59homeobox protein 33